PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015265-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 291aa    MW: 31695.5 Da    PI: 5.0554
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015265-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.2e-171155248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g++++eE++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
    NNU_015265-RA 11 GKFSQEEEQTILHLHSILGNK-WSAIATHLP-GRTDNEIKNFWNTHL 55
                     89*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.611159IPR017930Myb domain
SMARTSM007173.1E-15957IPR001005SANT/Myb domain
SuperFamilySSF466897.8E-151064IPR009057Homeodomain-like
PfamPF002496.7E-161155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-221156IPR009057Homeodomain-like
CDDcd001677.33E-131255No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGRSPCCDDN GKFSQEEEQT ILHLHSILGN KWSAIATHLP GRTDNEIKNF WNTHLKKKLI  60
QMGFDPMTHR PRTDMFSNLP QLLALANLRE LMNYHPWEED AVRLQSEAFR VAKLQYCQYL  120
LQTAASMTSS SFSNNLSSMA NVDAFNLLNS ISSIKDRPSG LSLPQLENST LSSLGIATSQ  180
AVHDSVHFPA HLPNLQPAAC SFQTPFNSEI AQGSDYTGFS QAESSPQSPS VVPPSPSPPP  240
PPPPPPPPPS ALCATETTVS NLGDACSTSS YGGAPFWAEL LLDESFIQEI G
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010269280.10.0PREDICTED: protein ODORANT1
TrEMBLA0A068TZV39e-90A0A068TZV3_COFCA; Uncharacterized protein
STRINGPOPTR_0007s05360.14e-88(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.16e-50myb domain protein 93